SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400522 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400522
Domain Number 1 Region: 340-547,574-655
Classification Level Classification E-value
Superfamily ARM repeat 1.8e-23
Family Armadillo repeat 0.094
Further Details:      
 
Domain Number 2 Region: 102-299
Classification Level Classification E-value
Superfamily RNI-like 1.05e-19
Family 28-residue LRR 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400522   Gene: ENSG00000162378   Transcript: ENST00000443756
Sequence length 674
Comment pep:known chromosome:GRCh37:1:53192126:53287401:1 gene:ENSG00000162378 transcript:ENST00000443756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDQAGAAMEEASPYSLLDICLNFLTTHLEKFCSARQDGTLCLQEPGVFPQEVADRLLR
TMAFHGLLNDGTVGIFRGNQMRLKRACIRKAKISAVAFRKAFCHHKLVELDATGVNADIT
ITDIISGLGSNKWIQQNLQCLVLNSLTLSLEDPYERCFSRLSGLRALSITNVLFYNEDLA
EVASLPRLESLDISNTSITDITALLACKDRLKSLTMHHLKCLKMTTTQILDVVRELKHLN
HLDISDDKQFTSDIALRLLEQKDILPNLVSLDVSGRKHVTDKAVEAFIQQRPSMQFVGLL
ATDAGYSEFLTGEGHLKVSGEANETQIAEALKRYSERAFFVREALFHLFSLTHVMEKTKP
EILKLVVTGMRNHPMNLPVQLAASACVFNLTKQDLAAGMPVRLLADVTHLLLKAMEHFPN
HQQLQKNCLLSLCSDRILQDVPFNRFEAAKLVMQWLCNHEDQNMQRMAVAIISILAAKLS
TEQTAQLGTELFIVRNNIAEVQELHSELMWKDFIDHISSLLHSVEVEVSYFAAGIIAHLI
SRGEQAWTLSRSQRNSLLDDLHSAILKWPTPECEMVAYRSFNPFFPLLGCFTTPGVQLWA
VWAMQHVCSKNPSRYCSMLIEEGGLQHLYNIKDHEHTDPHVQQIAVAILDSLEKHIVRHG
RPPPCKKQPQARLN
Download sequence
Identical sequences B4DK95
ENSP00000400522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]