SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000400667

Domain assignment for ENSP00000400667 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000400667
Domain Number 1	Region: 240-309
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	8.76e-17
Family	I set domains	0.031
Further Details:

Domain Number 2	Region: 22-117
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.000000000000143
Family	I set domains	0.027
Further Details:

Domain Number 3	Region: 143-210
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.000000362
Family	C2 set domains	0.077
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000400667 Gene: ENSG00000229058 Transcript: ENST00000449037
Sequence length	347
Comment	pep:known chromosome:GRCh37:HSCHR6_MHC_MANN:32188172:32191450:-1 gene:ENSG00000229058 transcript:ENST00000449037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS CVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM
Download sequence
Identical sequences	ENSP00000364195 ENSP00000372762 ENSP00000399686 ENSP00000400667 ENSP00000413391 gi\|332800973\|ref\|NP_001193869.1\| gi\|332800988\|ref\|NP_001193895.1\| ENSP00000364195 ENSP00000372762 ENSP00000399686 ENSP00000400667 ENSP00000413391 NP_001193869.1.87134 NP_001193869.1.92137 NP_001193895.1.87134 NP_001193895.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]