SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400702 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000400702
Domain Number - Region: 73-106
Classification Level Classification E-value
Superfamily UBA-like 0.000208
Family UBA domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400702   Gene: ENSG00000163214   Transcript: ENST00000417233
Sequence length 106
Comment pep:putative chromosome:GRCh37:2:39088928:39103075:-1 gene:ENSG00000163214 transcript:ENST00000417233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSENQEKVKALLRDLQEQDADAGSERGLSGEEEDDEPDCCNDERYWPAGQEPSLVPDLD
PLEYAGLASVEPYVPEFTVSPFAVQKLSRYGFNTERCQAVLRMCDG
Download sequence
Identical sequences A0A087WW12
ENSP00000400702 ENSP00000479840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]