SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401078 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401078
Domain Number 1 Region: 37-142
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.38e-19
Family Cystathionine synthase-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401078   Gene: ENSG00000139631   Transcript: ENST00000424990
Sequence length 146
Comment pep:putative chromosome:GRCh37:12:53565679:53574382:-1 gene:ENSG00000139631 transcript:ENST00000424990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL
RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLRKLRALVGWSSGDG
Download sequence
Identical sequences C9JTU8
ENSP00000401078 ENSP00000401078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]