SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401218 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401218
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.87e-22
Family Ubiquitin-related 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401218   Gene: ENSG00000228760   Transcript: ENST00000454248
Sequence length 206
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_MANN:31654975:31659714:-1 gene:ENSG00000228760 transcript:ENST00000454248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGP
GASVHDRNANSYVMVGTFNLPSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPP
QPPAVTPEPVALSSQTSEPVESEAPP
Download sequence
Identical sequences F6U1F2
ENSP00000389444 ENSP00000395856 ENSP00000399508 ENSP00000400611 ENSP00000401218 ENSP00000406302 ENSP00000413317 ENSP00000389444 ENSP00000395856 ENSP00000399508 ENSP00000400611 ENSP00000401218 ENSP00000406302 ENSP00000413317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]