SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401473 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000401473
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.000549
Family Mitochondrial carrier 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401473   Gene: ENSG00000075303   Transcript: ENST00000446236
Sequence length 37
Comment pep:known chromosome:GRCh37:7:87465425:87473179:-1 gene:ENSG00000075303 transcript:ENST00000446236 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSE
Download sequence
Identical sequences A0A2J8LGJ4 A0A2J8WKD1 F8WEL8
ENSP00000401473 ENSP00000401473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]