SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401661 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401661
Domain Number 1 Region: 71-100
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000174
Family p53 DNA-binding domain-like 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSP00000401661
Domain Number - Region: 28-126
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00697
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.015
Further Details:      
 
Domain Number - Region: 153-183
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0932
Family p53 DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401661   Gene: ENSG00000073282   Transcript: ENST00000434928
Sequence length 183
Comment pep:putative chromosome:GRCh37:3:189507464:189582057:1 gene:ENSG00000073282 transcript:ENST00000434928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLENNAQTQFSEPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSS
TFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTSLALSPRLECNGMISAHCNLH
LLGSSGSPFSASQVGGITGTRHHAQLIFGTTSAHCNLRLLDSSDSPFSASQYSTELKKLY
CQI
Download sequence
Identical sequences C9JW72
ENSP00000401661 ENSP00000401661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]