SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000401720

Domain assignment for ENSP00000401720 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000401720
Domain Number 1	Region: 69-315
Classification Level	Classification	E-value
Superfamily	Actin-like ATPase domain	1.04e-74
Family	Glycerol kinase	0.00000117
Further Details:

Domain Number 2	Region: 1-70
Classification Level	Classification	E-value
Superfamily	Actin-like ATPase domain	0.0000000000000168
Family	Glycerol kinase	0.00051
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000401720 Gene: ENSG00000198814 Transcript: ENST00000427190
Sequence length	354
Comment	pep:known chromosome:GRCh37:X:30671606:30747366:1 gene:ENSG00000198814 transcript:ENST00000427190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGD QSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALE GSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGI ICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQA DILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIR YSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
Download sequence
Identical sequences	XP_006724548.1.92137 XP_006724549.1.92137 XP_011543795.1.92137 XP_011543796.1.92137 XP_016799179.1.37143 XP_016802846.1.37143 XP_016884898.1.92137 ENSP00000401720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]