SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401867 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401867
Domain Number 1 Region: 56-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401867   Gene: ENSG00000213347   Transcript: ENST00000439742
Sequence length 206
Comment pep:known chromosome:GRCh37:5:176734206:176739310:-1 gene:ENSG00000213347 transcript:ENST00000439742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLRGFVAGQEHSYSHGGGAWL
Download sequence
Identical sequences A0A024R7S0 Q9BW11
ENSP00000401867 ENSP00000421463 ENSP00000401867 ENSP00000421463 9606.ENSP00000401867 gi|13775222|ref|NP_112590.1| NP_112590.1.87134 NP_112590.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]