SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402104 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402104
Domain Number 1 Region: 43-248
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.48e-52
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 549-659
Classification Level Classification E-value
Superfamily KA1-like 1.96e-47
Family Kinase associated domain 1, KA1 0.00000324
Further Details:      
 
Weak hits

Sequence:  ENSP00000402104
Domain Number - Region: 248-286
Classification Level Classification E-value
Superfamily UBA-like 0.0175
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402104   Gene: ENSG00000075413   Transcript: ENST00000440884
Sequence length 659
Comment pep:known chromosome:GRCh37:14:103851729:103969589:1 gene:ENSG00000075413 transcript:ENST00000440884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
ELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPF
VEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSS
SNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTS
TADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTAS
GGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGT
ASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSF
RFIKSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRE
RFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences ENSP00000402104 gi|193083131|ref|NP_001122393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]