SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402474 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402474
Domain Number 1 Region: 581-1019
Classification Level Classification E-value
Superfamily RNI-like 1.36e-75
Family 28-residue LRR 0.0000195
Further Details:      
 
Domain Number 2 Region: 183-270,297-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000379
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Domain Number 3 Region: 4-70
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000181
Family Pyrin domain, PYD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402474   Gene: ENSG00000022556   Transcript: ENST00000427260
Sequence length 1039
Comment pep:known chromosome:GRCh37:19:55477742:55512446:1 gene:ENSG00000022556 transcript:ENST00000427260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEMASLQVFEKMHRMD
LSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVIC
LGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPG
PFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVF
RDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLN
RVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFE
LMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQL
RGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIH
LSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGLANE
KRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMA
QFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQH
MLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADA
HRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWADL
SLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENCHLTEANCKDLAAV
LVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDITSDGCCDLTKLLQE
KSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQS
LVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLII
DTEKHHPWAERPSSHDFMI
Download sequence
Identical sequences ENSP00000402474 ENSP00000478318 ENSP00000482065 ENSP00000482309 ENSP00000482355 ENSP00000482465 ENSP00000482628 ENSP00000484150 ENSP00000484759 NP_001167554.1.87134 NP_001167554.1.92137 gi|291463280|ref|NP_001167554.1| ENSP00000402474 ENSP00000459149 ENSP00000460021 ENSP00000460135 ENSP00000460511 ENSP00000461424 ENSP00000461485 ENSP00000461657 ENSP00000474069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]