SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402559 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402559
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily UBA-like 0.0000000125
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402559   Gene: ENSG00000196141   Transcript: ENST00000421573
Sequence length 154
Comment pep:known chromosome:GRCh37:2:201242728:201303862:1 gene:ENSG00000196141 transcript:ENST00000421573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDS
ANEKPALIPREKKISILEEPSKALRGVTEGNRLL
Download sequence
Identical sequences A0A2J8N4Y5 C9JKE4
ENSP00000402559 ENSP00000402559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]