SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403360 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403360
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily EF-hand 7.87e-34
Family Calmodulin-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403360   Gene: ENSG00000106631   Transcript: ENST00000458240
Sequence length 148
Comment pep:putative chromosome:GRCh37:7:44178465:44180884:-1 gene:ENSG00000106631 transcript:ENST00000458240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINF
TVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMF
ALTPMDLAGNIDYKSLCYIITHGDEKEE
Download sequence
Identical sequences A0A2J8L9K4 C9JEG4
ENSP00000403360 ENSP00000403360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]