SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403365 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403365
Domain Number 1 Region: 63-107,203-379
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 8.37e-86
Family Pyruvate kinase 0.0000000263
Further Details:      
 
Domain Number 2 Region: 383-515
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.13e-45
Family Pyruvate kinase, C-terminal domain 0.000000868
Further Details:      
 
Domain Number 3 Region: 102-203
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 9.07e-30
Family Pyruvate kinase beta-barrel domain 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403365   Gene: ENSG00000067225   Transcript: ENST00000449901
Sequence length 516
Comment pep:known chromosome:GRCh37:15:72491446:72523531:-1 gene:ENSG00000067225 transcript:ENST00000449901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPEAQPQRTKGPQQPCRSPIVKPGLPSFRPSSCTQPWLTHSWSTCAAWTLIHHPSQPGT
LASSVPLYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELK
KGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVT
EVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVR
KVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIG
RCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAV
RMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSG
RSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMN
VGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
Download sequence
Identical sequences ENSP00000403365 gi|332164779|ref|NP_001193727.1| NP_001193727.1.87134 NP_001193727.1.92137 ENSP00000403365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]