SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403369 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403369
Domain Number 1 Region: 293-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000121
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 256-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000785
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 392-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000134
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403369   Gene: ENSG00000124092   Transcript: ENST00000426658
Sequence length 451
Comment pep:known chromosome:GRCh37:20:56074610:56099923:-1 gene:ENSG00000124092 transcript:ENST00000426658 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAATEISVLSEQFTKIKELELMPEKGLKEEEKDGVCREKDHRSPSELEAERTSGAFQDSV
LEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLL
WLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVSLAETTGLI
KLEEEQEKNQLLAERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEK
AKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKTFRTVTLL
RNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYASVEASKLKRH
VRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQK
HGENVPKYQCPHCATIIARKSDLRFLGLPFP
Download sequence
Identical sequences F5H2V8
ENSP00000403369 ENSP00000403369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]