SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403543 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403543
Domain Number 1 Region: 63-105
Classification Level Classification E-value
Superfamily UBA-like 0.00000000459
Family TAP-C domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  ENSP00000403543
Domain Number - Region: 111-229
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.034
Family Tex N-terminal region-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403543   Gene: ENSG00000150401   Transcript: ENST00000438545
Sequence length 244
Comment pep:known chromosome:GRCh37:13:114113627:114144923:-1 gene:ENSG00000150401 transcript:ENST00000438545 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XRRRRRAGCGRPSPASCAGRSAWIRGRNAPRAREPERWRRRRGTAGSAGLTRSREGRPGH
KLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDK
KKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEF
LDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLGSPPFLNVK
ALHH
Download sequence
Identical sequences H7C216
ENSP00000403543 ENSP00000403543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]