SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403644 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403644
Domain Number 1 Region: 1-474
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.37e-153
Family Pyridoxal-dependent decarboxylase 0.0000000000000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403644   Gene: ENSG00000132437   Transcript: ENST00000444124
Sequence length 480
Comment pep:known chromosome:GRCh37:7:50526163:50633154:-1 gene:ENSG00000132437 transcript:ENST00000444124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
Download sequence
Identical sequences A0A0S2Z3N4 P20711
ENSP00000350616 ENSP00000403644 ENSP00000350616 ENSP00000403644 9606.ENSP00000350616 ENSP00000350616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]