SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404422 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404422
Domain Number 1 Region: 99-155
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000604
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404422   Gene: ENSG00000126217   Transcript: ENST00000420013
Sequence length 189
Comment pep:novel chromosome:GRCh37:13:113743950:113751146:1 gene:ENSG00000126217 transcript:ENST00000420013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKKLEERKTDPLSLEGYVSSAPLTKPPEKGKASPTSPDKKAKRHEVKSDPTPFGVRGWSK
TSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKGGPDALRVRS
GDVVELVQEGDEGLWYVRDPTTGKEGWVPASSLSVRLGPSGSAQCLSSSESSPGSAVLSN
SSSCSEGGQ
Download sequence
Identical sequences H7C275
ENSP00000404422 ENSP00000404422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]