SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405062 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405062
Domain Number 1 Region: 77-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000291
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405062   Gene: ENSG00000177551   Transcript: ENST00000429731
Sequence length 107
Comment pep:known chromosome:GRCh37:1:116380673:116383362:-1 gene:ENSG00000177551 transcript:ENST00000429731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHP
QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTL
Download sequence
Identical sequences A0A2J8JRZ2 A0A2J8ULN5 A6PVY9
ENSP00000405062 ENSP00000405062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]