SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405111 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405111
Domain Number 1 Region: 72-118
Classification Level Classification E-value
Superfamily UBA-like 0.000000312
Family UBA domain 0.031
Further Details:      
 
Domain Number 2 Region: 198-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000118
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSP00000405111
Domain Number - Region: 235-317
Classification Level Classification E-value
Superfamily UBC-like 0.00264
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405111   Gene: ENSG00000163214   Transcript: ENST00000457308
Sequence length 472
Comment pep:known chromosome:GRCh37:2:39025422:39094380:-1 gene:ENSG00000163214 transcript:ENST00000457308 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTSENQEKVKALLRDLQEQDADAGSERGLSGEEEDDEPDCCNDERYWPAGQEPSLVPDLD
PLEYAGLASVEPYVPEFTVSPFAVQKLSRYGFNTERCQAVLRMCDGDVGASLEHLLTQCF
SETFGERMKISEAVNQISLDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELEYLT
SRFRKSKPKESTKNVQENSLEICKFYLKGNCKFGSKCRFKHEVPPNQIVGRIERSVDDSH
LNAIEDASFLYELEIRFSKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAE
TSEPVVYSLITLLEEESEIVKLLTNTHHKYSDPPVNFLPVPSRTRINNPACHKTVIPNNS
FVSNQIPEVEKASESEESDEDDGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKIC
KQFRMKQASRQFQSILQERQSLPAWEERETILNLLRKHQVVVISGMTGTYLF
Download sequence
Identical sequences A0A087WZ11
ENSP00000405111 ENSP00000482275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]