SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405434 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405434
Domain Number 1 Region: 297-563
Classification Level Classification E-value
Superfamily RNI-like 1.26e-31
Family Cyclin A/CDK2-associated p19, Skp2 0.0098
Further Details:      
 
Domain Number 2 Region: 570-659
Classification Level Classification E-value
Superfamily RNI-like 4.79e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.081
Further Details:      
 
Domain Number 3 Region: 242-296
Classification Level Classification E-value
Superfamily F-box domain 0.000000000278
Family F-box domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSP00000405434
Domain Number - Region: 10-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405434   Gene: ENSG00000161040   Transcript: ENST00000448002
Sequence length 684
Comment pep:known chromosome:GRCh37:7:102453677:102715286:-1 gene:ENSG00000161040 transcript:ENST00000448002 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASLRNANPRLKNYFKENYIPQVCEALLCGILVTCPEDPLRYLEGMIMVIIKSGLQNLLW
DMCITPSMKPNIRRLSETYLEQLFELDDQLMTPELMIKACSFYTGHLVKTHFCTWRDIAR
TNENVVLAEKMNRAVTCYNFRLQKSVFHHWHSYMEDQKEKLKNILLRIQQIIYCHKLTII
LTKWRNTARHKSKKKEDELILKHELQLKKWKNRLILKRAAAEESNFPERSSSEVFLVDET
LKCDISLLPERAILQIFFYLSLKDVIICGQVNHAWMLMTQLNSLWNAIDFSSVKNVIPDK
YIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCRNLQELNVSDCPTFTDESMRHISEGC
PGVLCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLD
LSGCTQISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHIS
DCTFRALSACKLRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPL
KQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYL
SLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHKKLKELSVSECYRITDD
GIQIARMEASANKEGLPKTPIADY
Download sequence
Identical sequences E7ERH8
ENSP00000405434 ENSP00000405434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]