SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405896 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405896
Domain Number 1 Region: 8-45,163-304,350-514
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000243
Family 28-residue LRR 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405896   Gene: ENSG00000155034   Transcript: ENST00000458142
Sequence length 685
Comment pep:putative chromosome:GRCh37:7:5528809:5541550:-1 gene:ENSG00000155034 transcript:ENST00000458142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVREL
KQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYAR
LAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQ
LPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHC
LSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLARLRHLR
SLSLPVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQSCPSPFSGQACPQPSSVFW
SLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHL
TLAQLPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLE
QPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLAFMARCLQVVMCHLFTGESLAT
CKSLQQSLLRRWGEVTGRRPQLFTELREEPSARTSRATGRRQPCLPDSGVVCCPCGRPLA
VSGIILVGVSPSLVVKTTCVYRVLFKNLDYASIFFLVCLFETESHSVVQAGVQWRDLSSL
QPLLSGLQPQPPEQLGLQVCTTIPG
Download sequence
Identical sequences H0Y6I6
ENSP00000405896 ENSP00000405896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]