SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405928 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405928
Domain Number 1 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-23
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 101-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000656
Family B-box zinc-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405928   Gene: ENSG00000204599   Transcript: ENST00000458516
Sequence length 144
Comment pep:known chromosome:GRCh37:6:30294256:30297528:1 gene:ENSG00000204599 transcript:ENST00000458516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLD
Download sequence
Identical sequences A2AAZ5
ENSP00000394599 ENSP00000400243 ENSP00000405928 ENSP00000406034 ENSP00000406984 ENSP00000411500 ENSP00000415671 ENSP00000394599 ENSP00000400243 ENSP00000405928 ENSP00000406034 ENSP00000406984 ENSP00000411500 ENSP00000415671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]