SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405961 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405961
Domain Number 1 Region: 78-204
Classification Level Classification E-value
Superfamily RNI-like 9.03e-19
Family Cyclin A/CDK2-associated p19, Skp2 0.084
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000249
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405961   Gene: ENSG00000107872   Transcript: ENST00000440407
Sequence length 208
Comment pep:known chromosome:GRCh37:10:104180286:104181960:1 gene:ENSG00000107872 transcript:ENST00000440407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLA
GLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGD
Download sequence
Identical sequences A0A2J8PD00 X6RHD7
ENSP00000405961 ENSP00000405961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]