SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406113 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406113
Domain Number 1 Region: 18-170
Classification Level Classification E-value
Superfamily UBC-like 2.54e-42
Family UBC-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406113   Gene: ENSG00000184182   Transcript: ENST00000434655
Sequence length 171
Comment pep:known chromosome:GRCh37:2:238877435:238949936:1 gene:ENSG00000184182 transcript:ENST00000434655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKED
Download sequence
Identical sequences A0A2J8JQ15 A0A2J8TPM6 C9J9P8
ENSP00000406113 ENSP00000406113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]