SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406137 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406137
Domain Number 1 Region: 95-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000115
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 11-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000218
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406137   Gene: ENSG00000116016   Transcript: ENST00000449347
Sequence length 259
Comment pep:known chromosome:GRCh37:2:46523747:46588229:1 gene:ENSG00000116016 transcript:ENST00000449347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDD
Download sequence
Identical sequences A0A2J8LL66 C9J9N2
ENSP00000406137 ENSP00000406137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]