SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406339 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406339
Domain Number 1 Region: 46-77
Classification Level Classification E-value
Superfamily UBA-like 0.0000000395
Family TS-N domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406339   Gene: ENSG00000123297   Transcript: ENST00000417094
Sequence length 89
Comment pep:known chromosome:GRCh37:12:58176564:58179983:1 gene:ENSG00000123297 transcript:ENST00000417094 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQTESCSVAQAGVQ
Download sequence
Identical sequences F8WCK2
ENSP00000406339 ENSP00000406339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]