SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406404 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406404
Domain Number 1 Region: 74-183
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000549
Family SEA domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000406404
Domain Number - Region: 27-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000738
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406404   Gene: ENSG00000169894   Transcript: ENST00000422757
Sequence length 308
Comment pep:known chromosome:GRCh37:7:100552886:100610461:1 gene:ENSG00000169894 transcript:ENST00000422757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDNGGTWEQGQCACLPGFSGDRCQLQTRCQNGGQWDGLKCQCPSTFYGSSCEFAVEQVDL
DVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFKGVEILSL
RNGSIVVDYLVLLEMPFSPQLESEYEQVKTTLKEGLQNASQDANSCQDSQTLCFKPDSIK
VNNNSKTELTPEAICRRAAPTGYEEFYFPLVEATRLRCVTKCTSGVDNAIDCHQGQCVLE
TSGPACRSWDQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIKR
PEMTSSSV
Download sequence
Identical sequences ENSP00000406404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]