SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406881 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406881
Domain Number 1 Region: 26-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.51e-282
Family GABA-aminotransferase-like 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406881   Gene: ENSG00000182199   Transcript: ENST00000414700
Sequence length 483
Comment pep:putative chromosome:GRCh37:12:57623869:57628509:1 gene:ENSG00000182199 transcript:ENST00000414700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKT
GLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAA
KVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFP
SLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHL
VLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDF
RRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGF
DEH
Download sequence
Identical sequences A0A024RB99
ENSP00000406881 ENSP00000413770 ENSP00000452419 gi|261862348|ref|NP_001159829.1| gi|261862350|ref|NP_001159830.1| gi|261862352|ref|NP_001159831.1| NP_001159829.1.87134 NP_001159829.1.92137 NP_001159830.1.87134 NP_001159830.1.92137 NP_001159831.1.87134 NP_001159831.1.92137 4pvf_A 4pvf_B ENSP00000406881 ENSP00000413770 ENSP00000452419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]