SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407204 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407204
Domain Number 1 Region: 93-221
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.99e-26
Family GABA-aminotransferase-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407204   Gene: ENSG00000158578   Transcript: ENST00000455688
Sequence length 221
Comment pep:known chromosome:GRCh37:X:55046767:55057410:-1 gene:ENSG00000158578 transcript:ENST00000455688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLSFVRPQCRATDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFKTDLPSSLV
SVSLRKPFSGPQEQEQISGKVTHLIQNNMPGNYVFSYDQFFRDKIMEKKQDHTYRVFKTV
NRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRN
ISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTL
Download sequence
Identical sequences H0Y6R3
ENSP00000407204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]