SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407693 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407693
Domain Number 1 Region: 26-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-70
Family SPRY domain 0.00000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407693   Gene: ENSG00000233948   Transcript: ENST00000443804
Sequence length 231
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_MCF:28870945:28875506:-1 gene:ENSG00000233948 transcript:ENST00000443804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSADSLEGGILDLGSVLSHILPVSELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSY
LQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAP
QNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFS
HATFCGPVRPYFSLSYSGGKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences A0A140T9N6
ENSP00000407693 ENSP00000407693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]