SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407801 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407801
Domain Number 1 Region: 86-333
Classification Level Classification E-value
Superfamily vWA-like 9.78e-86
Family Integrin A (or I) domain 0.00000000029
Further Details:      
 
Domain Number 2 Region: 329-419
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-33
Family Integrin domains 0.0000031
Further Details:      
 
Domain Number 3 Region: 585-669
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.63e-24
Family Integrin beta tail domain 0.0000037
Further Details:      
 
Domain Number 4 Region: 543-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 5 Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Domain Number 6 Region: 2-36
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000994
Family Plexin repeat 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSP00000407801
Domain Number - Region: 469-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407801   Gene: ENSG00000259207   Transcript: ENST00000435993
Sequence length 751
Comment pep:known chromosome:GRCh37:17:45331263:45421658:1 gene:ENSG00000259207 transcript:ENST00000435993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVT
QVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQ
MRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVT
RFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGR
LAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNY
SELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIP
GLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQA
EPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGEC
LCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCT
TRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFD
RGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYV
VEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDT
EILLYYCSFILVHQSLESLRTEFTSKQKDGN
Download sequence
Identical sequences B4DTY9
ENSP00000456711 ENSP00000407801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]