SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408233 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408233
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-25
Family SPRY domain 0.00078
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-20
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-19
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000408233
Domain Number - Region: 384-425
Classification Level Classification E-value
Superfamily ARM repeat 0.00115
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408233   Gene: ENSG00000226060   Transcript: ENST00000447711
Sequence length 539
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_DBB:30142515:30171430:-1 gene:ENSG00000226060 transcript:ENST00000447711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences A0A024RCP3 H2PKZ2 Q12899
ENSP00000331131 ENSP00000387530 ENSP00000388005 ENSP00000389203 ENSP00000389386 ENSP00000390258 ENSP00000393827 ENSP00000395820 ENSP00000331131 ENSP00000373102 ENSP00000379806 ENSP00000389203 ENSP00000390258 ENSP00000391879 ENSP00000392805 ENSP00000393011 ENSP00000394371 ENSP00000394421 ENSP00000395491 ENSP00000396188 ENSP00000398545 ENSP00000402395 ENSP00000406707 ENSP00000407294 ENSP00000407876 ENSP00000408233 ENSP00000409182 ENSP00000410446 ENSP00000414248 ENSP00000415328 ENSP00000415755 ENSP00000416737 NP_001229712.1.87134 NP_001229712.1.92137 NP_003440.1.87134 NP_003440.1.92137 XP_005249431.1.92137 XP_005249432.1.92137 XP_005249433.1.92137 XP_005249434.1.92137 XP_005249435.1.92137 XP_006715243.1.92137 XP_009243247.1.23681 gi|338753391|ref|NP_001229712.1| gi|4508005|ref|NP_003440.1| ENSP00000331131 ENSP00000373102 ENSP00000379806 ENSP00000389203 ENSP00000390258 ENSP00000391879 ENSP00000392805 ENSP00000393011 ENSP00000394371 ENSP00000394421 ENSP00000395491 ENSP00000396188 ENSP00000398545 ENSP00000402395 ENSP00000406707 ENSP00000407294 ENSP00000407876 ENSP00000408233 ENSP00000409182 ENSP00000410446 ENSP00000414248 ENSP00000415328 ENSP00000415755 ENSP00000416737 ENSPPYP00000019270 9600.ENSPPYP00000019270 9606.ENSP00000331131 9606.ENSP00000391879 9606.ENSP00000394371 9606.ENSP00000398545 9606.ENSP00000408233 9606.ENSP00000409182 9606.ENSP00000414248 9606.ENSP00000415328 ENSPPYP00000019270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]