SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409346 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409346
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 227-274
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000017
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409346   Gene: ENSG00000114737   Transcript: ENST00000443053
Sequence length 275
Comment pep:known chromosome:GRCh37:3:50643927:50649203:-1 gene:ENSG00000114737 transcript:ENST00000443053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLEHTSHCPHHDDDTAMDTPLPRPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFL
EEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGT
FLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHY
VASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSL
QHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL
Download sequence
Identical sequences NP_037456.5.87134 NP_037456.5.92137 9606.ENSP00000409346 ENSP00000409346 gi|195976771|ref|NP_037456.5| ENSP00000409346 ENSP00000294173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]