SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409447 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409447
Domain Number 1 Region: 400-467
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409447   Gene: ENSG00000196628   Transcript: ENST00000457482
Sequence length 511
Comment pep:known chromosome:GRCh37:18:52894920:52989525:-1 gene:ENSG00000196628 transcript:ENST00000457482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCAYTIPGMGGNSLMYYYNGKAVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDG
HHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNS
FSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVL
RNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVA
LRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGD
ENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLR
VRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRR
EEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A1D5R9T2 A0A2I2Z9E2 A0A2I3N3Q9 A0A2I3S5L1 A0A2J8UET7 A0A2K5HCZ9 A0A2K5NQE6 A0A2K5W472 A0A2K5XNF7 A0A2K6DUU2 A0A2K6MRS9 A0A2K6QNS5
ENSP00000409447 ENSP00000409447 NP_001230163.1.87134 NP_001230163.1.92137 XP_004087750.1.23891 XP_005586681.1.63531 XP_008950873.1.60992 XP_009250671.1.23681 XP_010374177.1.97406 XP_011731769.1.29376 XP_011804566.1.43180 XP_011827119.1.47321 XP_011924371.1.92194 XP_014977537.1.72884 XP_016789267.1.37143 XP_017705636.1.44346 XP_018869492.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]