SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409634 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409634
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000068
Family MOSC (MOCO sulphurase C-terminal) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409634   Gene: ENSG00000186205   Transcript: ENST00000443880
Sequence length 119
Comment pep:putative chromosome:GRCh37:1:220970097:220982318:1 gene:ENSG00000186205 transcript:ENST00000443880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCD
VYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKRESDVHTDPHG
Download sequence
Identical sequences X6RIL1
ENSP00000409634 ENSP00000409634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]