SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409716 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409716
Domain Number 1 Region: 176-391
Classification Level Classification E-value
Superfamily RNI-like 8.44e-32
Family Cyclin A/CDK2-associated p19, Skp2 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSP00000409716
Domain Number - Region: 155-186
Classification Level Classification E-value
Superfamily F-box domain 0.000785
Family F-box domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409716   Gene: ENSG00000161040   Transcript: ENST00000456695
Sequence length 453
Comment pep:known chromosome:GRCh37:7:102453680:102715172:-1 gene:ENSG00000161040 transcript:ENST00000456695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPELMIKACSFYTGHLVKTHFCTWRDIARTNENVVLAEKMNRAVTCYNFRLQKSVFHHW
HSYMEDQKEKLKNILLRIQQIIYCHKLTIILTKWRNTARHKSKKKEDELILKHELQLKKW
KNRLILKRAAAEESNFPERSSSEVFLVDETLKCDISLLPERAILQIFFYLSLKDVIICGQ
VNHAWMLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS
VSHCRNLQELNVSDCPTFTDESMRHISEGCPGVLCLNLSNTTITNRTMRLLPRHFHNLQN
LSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQITDSAMEMLSAKCHYLHILDISGC
VLLTDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKVQQQEYNTNDPPRWFGYDRE
GNPVTELDNITSSKGALELTVKKSTYSSEDQAA
Download sequence
Identical sequences ENSP00000368608 ENSP00000409716 ENSP00000409716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]