SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411294 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411294
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily UBA-like 0.00000000587
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411294   Gene: ENSG00000196141   Transcript: ENST00000439395
Sequence length 115
Comment pep:known chromosome:GRCh37:2:201170999:201284120:1 gene:ENSG00000196141 transcript:ENST00000439395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDS
Download sequence
Identical sequences A0A2J8N4X6 C9J8M7
ENSP00000411294 ENSP00000411294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]