SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411435 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411435
Domain Number 1 Region: 79-184
Classification Level Classification E-value
Superfamily RNI-like 8.44e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.058
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000209
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411435   Gene: ENSG00000107872   Transcript: ENST00000432590
Sequence length 190
Comment pep:known chromosome:GRCh37:10:104178946:104181906:1 gene:ENSG00000107872 transcript:ENST00000432590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLA
GLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQR
Download sequence
Identical sequences A0A2J8PD03 X6RJB2
ENSP00000411435 ENSP00000411435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]