SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411516 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411516
Domain Number 1 Region: 294-324
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000174
Family HLH, helix-loop-helix DNA-binding domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411516   Gene: ENSG00000072310   Transcript: ENST00000423161
Sequence length 325
Comment pep:novel chromosome:GRCh37:17:17722341:17726932:-1 gene:ENSG00000072310 transcript:ENST00000423161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLE
AFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGAL
LPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQ
VQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVLLQPHFIKADSLLLTAMKTDGATVKAAG
LSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRT
AHNAIEKRYRSSINDKIIELKDLVV
Download sequence
Identical sequences F6V242
ENSP00000411516 ENSP00000411516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]