SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412261 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412261
Domain Number 1 Region: 16-89
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-16
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412261   Gene: ENSG00000070950   Transcript: ENST00000413832
Sequence length 91
Comment pep:known chromosome:GRCh37:3:8983480:9005457:-1 gene:ENSG00000070950 transcript:ENST00000413832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRILDELVKSLNFARNH
Download sequence
Identical sequences C9J0Q4
ENSP00000412261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]