SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412551 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412551
Domain Number 1 Region: 144-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000412551
Domain Number - Region: 203-292
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0272
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 
Domain Number - Region: 15-117
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412551   Gene: ENSG00000112561   Transcript: ENST00000420312
Sequence length 391
Comment pep:known chromosome:GRCh37:6:41651717:41702798:-1 gene:ENSG00000112561 transcript:ENST00000420312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQ
SPPPVPGEVLKLDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLV
GVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKA
NDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARV
HGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPT
QPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLPL
ASDPLLSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences NP_001258872.1.87134 NP_001258872.1.92137 ENSP00000412551 ENSP00000412551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]