SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412610 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412610
Domain Number 1 Region: 217-248
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000181
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 62-103
Classification Level Classification E-value
Superfamily PA domain 0.0000000575
Family PA domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412610   Gene: ENSG00000133135   Transcript: ENST00000418562
Sequence length 249
Comment pep:known chromosome:GRCh37:X:105937024:106033435:1 gene:ENSG00000133135 transcript:ENST00000418562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAYVTVTYYNETSNYTAIETCECGVYGLASPVANAMGVVGIPKNNNYQACDHNTEFSNT
KKPWIALIERGNCTFSEKIQTAGRRNADAVVIYNAPETGNQTIQMANFGAVDIVAIMIGN
LKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARR
LRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRIL
TCNHIFHKT
Download sequence
Identical sequences A0A2J8K3M5 Q5JSK4
ENSP00000412610 ENSP00000412610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]