SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412990 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412990
Domain Number 1 Region: 80-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-35
Family RecA protein-like (ATPase-domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000876
Family C-terminal domain of RNA polymerase alpha subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412990   Gene: ENSG00000126215   Transcript: ENST00000445556
Sequence length 346
Comment pep:known chromosome:GRCh37:14:104163955:104181823:-1 gene:ENSG00000126215 transcript:ENST00000445556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF
IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA
TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
Download sequence
Identical sequences O43542 Q53XC8
9606.ENSP00000343392 gi|153946427|ref|NP_001093588.1| gi|153946430|ref|NP_001093589.1| gi|4885659|ref|NP_005423.1| ENSP00000343392 GO.36482 O43542 ENSP00000343392 ENSP00000412990 ENSP00000451362 ENSP00000451974 ENSP00000452598 ENSP00000343392 ENSP00000451362 ENSP00000451974 ENSP00000452598 NP_001093588.1.87134 NP_001093588.1.92137 NP_001093589.1.87134 NP_001093589.1.92137 NP_005423.1.87134 NP_005423.1.92137 XP_005268103.1.92137 XP_011535440.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]