SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413129 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413129
Domain Number 1 Region: 27-147
Classification Level Classification E-value
Superfamily RNI-like 1.96e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413129   Gene: ENSG00000125122   Transcript: ENST00000433915
Sequence length 161
Comment pep:novel chromosome:GRCh37:16:67241551:67260916:-1 gene:ENSG00000125122 transcript:ENST00000433915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKVLQFLQLRQLSLS
LLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQ
TLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCV
Download sequence
Identical sequences ENSP00000413129 ENSP00000413129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]