SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413648 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413648
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily UBA-like 0.000000153
Family UBA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413648   Gene: ENSG00000196141   Transcript: ENST00000438761
Sequence length 238
Comment pep:putative chromosome:GRCh37:2:201257800:201332101:1 gene:ENSG00000196141 transcript:ENST00000438761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGQTNMIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWNMTGKK
KNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDSANEKP
ALIPREKKISILEEPSKALRGVTGPNIEKSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIK
AAFAELHNCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLTDLASQMAEMQLA
Download sequence
Identical sequences A0A2J8N4V8 C9JW67
ENSP00000413648 ENSP00000413648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]