SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413756 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413756
Domain Number 1 Region: 33-126
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.32e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00071
Further Details:      
 
Domain Number 2 Region: 138-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-17
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413756   Gene: ENSG00000157985   Transcript: ENST00000453371
Sequence length 259
Comment pep:novel chromosome:GRCh37:2:236954581:237034126:1 gene:ENSG00000157985 transcript:ENST00000453371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSENSESGTGMCPTHECRPSDLDLTAWELLGGDPNWASLNLGALMCIECSGIHRNLGTHL
SRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTREEKERWIRAKYEQ
KLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACR
KGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPN
LSRRNNNRNNSSGRVPTII
Download sequence
Identical sequences ENSP00000413756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]