SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414023 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414023
Domain Number 1 Region: 29-108
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000294
Family 28-residue LRR 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414023   Gene: ENSG00000125122   Transcript: ENST00000447579
Sequence length 182
Comment pep:novel chromosome:GRCh37:16:67242293:67260691:-1 gene:ENSG00000125122 transcript:ENST00000447579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKDASVLSMIPALGL
SLRVLDLSSCVALTNRTLQAICTYLTHLSVLRLAWCRELCDWGLRGLGEPVQGTQVWDPR
GLGGRGGPWDQLPSCPSQVSVGVFKGKLRRNLRSKGFFPQSRPELEHQASGTKDACPEPQ
GP
Download sequence
Identical sequences ENSP00000414023 ENSP00000414023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]