SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414165 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414165
Domain Number 1 Region: 36-168
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.36e-27
Family Cystathionine synthase-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414165   Gene: ENSG00000132330   Transcript: ENST00000413463
Sequence length 170
Comment pep:novel chromosome:GRCh37:2:238969642:238990843:1 gene:ENSG00000132330 transcript:ENST00000413463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSSGAGMEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTK
AMWEAWGNPSSPYSAAVTFVPVSKVSGQAEVDDILAAVRPTTRLVTIMLANNETGIVMPV
PEISQRIKALNQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIV
Download sequence
Identical sequences C9JNL5
ENSP00000414165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]