SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414180 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414180
Domain Number 1 Region: 112-273
Classification Level Classification E-value
Superfamily RNI-like 1.96e-46
Family 28-residue LRR 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414180   Gene: ENSG00000163157   Transcript: ENST00000416280
Sequence length 276
Comment pep:known chromosome:GRCh37:1:151142464:151148457:-1 gene:ENSG00000163157 transcript:ENST00000416280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPT
GPLDREALLQYLEQQALEVKERDDLVPFTGEKKGVVQPDKYKPVPDEPPNPTNIEEILKR
VRSNDKELEEVNLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLR
ENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEMEMATVLEQC
PSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
Download sequence
Identical sequences XP_008968672.1.60992 XP_011793235.1.43180 ENSP00000414180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]